C21ORF13 antibody (70R-1973)

Rabbit polyclonal C21ORF13 antibody

Synonyms Polyclonal C21ORF13 antibody, Anti-C21ORF13 antibody, Chromosome ORF-21 antibody, Chromosome ORF 21, Chromosome 21 ORF, Chromosome ORF-21, Chromosome ORF 21 antibody, MGC33295 antibody
Cross Reactivity Human
Applications WB
Immunogen C21ORF13 antibody was raised using a synthetic peptide corresponding to a region with amino acids GSEEPLQSKESHPLPPSQASTSHAFGDSKVTVVNSIKPSSPTEGKRKIII
Assay Information C21ORF13 Blocking Peptide, catalog no. 33R-3556, is also available for use as a blocking control in assays to test for specificity of this C21ORF13 antibody

Images

Western Blot analysis using C21ORF13 antibody (70R-1973)

C21ORF13 antibody (70R-1973) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 76 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C21ORF13 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of the C21orf13 protein has not been widely studied, and is yet to be fully elucidated.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using C21ORF13 antibody (70R-1973) | C21ORF13 antibody (70R-1973) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £276.43
Size: 50 ug
OR
Shipping
View Our Distributors