C21ORF45 antibody (70R-3295)

Rabbit polyclonal C21ORF45 antibody raised against the N terminal Of C21Orf45

Synonyms Polyclonal C21ORF45 antibody, Anti-C21ORF45 antibody, Chromosome 21 ORF, MIS18alpha antibody, Chromosome ORF-21 antibody, Chromosome ORF-21, FASP1 antibody, C21orf46 antibody, Chromosome ORF 21, Chromosome ORF 21 antibody, B28 antibody
Specificity C21ORF45 antibody was raised against the N terminal Of C21Orf45
Cross Reactivity Human
Applications WB
Immunogen C21ORF45 antibody was raised using the N terminal Of C21Orf45 corresponding to a region with amino acids MAGVRSLRCSRGCAGGCECGDKGKCSDSSLLGKRLSEDSSRHQLLQKWAS
Assay Information C21ORF45 Blocking Peptide, catalog no. 33R-5672, is also available for use as a blocking control in assays to test for specificity of this C21ORF45 antibody

Images

Western Blot analysis using C21ORF45 antibody (70R-3295)

C21ORF45 antibody (70R-3295) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 26 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C21ORF45 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance C21ORF45 is required for recruitment of CENPA to centromeres and normal chromosome segregation during mitosis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using C21ORF45 antibody (70R-3295) | C21ORF45 antibody (70R-3295) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors