C21ORF62 antibody (70R-5266)

Rabbit polyclonal C21ORF62 antibody raised against the middle region of C21Orf62

Synonyms Polyclonal C21ORF62 antibody, Anti-C21ORF62 antibody, Chromosome ORF-21, C21orf120 antibody, B37 antibody, Chromosome 21 ORF, Chromosome ORF 21, PRED81 antibody, Chromosome ORF-21 antibody, Chromosome ORF 21 antibody
Specificity C21ORF62 antibody was raised against the middle region of C21Orf62
Cross Reactivity Human
Applications WB
Immunogen C21ORF62 antibody was raised using the middle region of C21Orf62 corresponding to a region with amino acids STNTLPTEYLAICGLKRLRINMEAKHPFPEQSLLIHSGGDSDSREKPMWL
Assay Information C21ORF62 Blocking Peptide, catalog no. 33R-8879, is also available for use as a blocking control in assays to test for specificity of this C21ORF62 antibody

Images

Western Blot analysis using C21ORF62 antibody (70R-5266)

C21ORF62 antibody (70R-5266) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 28 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C21ORF62 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of C21orf62 protein has not been widely studied, and is yet to be fully elucidated.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using C21ORF62 antibody (70R-5266) | C21ORF62 antibody (70R-5266) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors