C22ORF25 antibody (70R-4179)

Rabbit polyclonal C22ORF25 antibody raised against the N terminal Of C22Orf25

Synonyms Polyclonal C22ORF25 antibody, Anti-C22ORF25 antibody, DKFZp761P1121 antibody, Chromosome ORF 22 antibody, Chromosome ORF-22, Chromosome 22 ORF, Chromosome ORF-22 antibody, Chromosome ORF 22
Specificity C22ORF25 antibody was raised against the N terminal Of C22Orf25
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen C22ORF25 antibody was raised using the N terminal Of C22Orf25 corresponding to a region with amino acids MCIIFFKFDPRPVSKNAYRLILAANRDEFYSRPSKLADFWGNNNEILSGL
Assay Information C22ORF25 Blocking Peptide, catalog no. 33R-5813, is also available for use as a blocking control in assays to test for specificity of this C22ORF25 antibody


Western Blot analysis using C22ORF25 antibody (70R-4179)

C22ORF25 antibody (70R-4179) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 31 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C22ORF25 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of C22orf25 has not been widely studied, and is yet to be fully elucidated.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using C22ORF25 antibody (70R-4179) | C22ORF25 antibody (70R-4179) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors