C2ORF25 antibody (70R-2461)

Rabbit polyclonal C2ORF25 antibody raised against the middle region of C2Orf25

Synonyms Polyclonal C2ORF25 antibody, Anti-C2ORF25 antibody, Chromosome ORF-2, CL25022 antibody, Chromosome ORF-2 antibody, Chromosome ORF 2 antibody, Chromosome ORF 2, Chromosome 2 ORF
Specificity C2ORF25 antibody was raised against the middle region of C2Orf25
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen C2ORF25 antibody was raised using the middle region of C2Orf25 corresponding to a region with amino acids RAEGYWADFIDPSSGLAFFGPYTNNTLFETDERYRHLGFSVDDLGCCKVI
Assay Information C2ORF25 Blocking Peptide, catalog no. 33R-7803, is also available for use as a blocking control in assays to test for specificity of this C2ORF25 antibody


Western Blot analysis using C2ORF25 antibody (70R-2461)

C2ORF25 antibody (70R-2461) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 33 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C2ORF25 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Vitamin B12 (cobalamin) is an essential cofactor in several metabolic pathways. Intracellular conversion of cobalamin to adenosylcobalamin in mitochondria and to methylcobalamin in cytoplasm is necessary for homeostasis of methylmalonic acid and homocysteine. C2ORF25 encodes a protein involved in an early step of cobalamin metabolism.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using C2ORF25 antibody (70R-2461) | C2ORF25 antibody (70R-2461) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors