C3ORF39 antibody (70R-1568)

Rabbit polyclonal C3ORF39 antibody raised against the middle region of C3Orf39

Synonyms Polyclonal C3ORF39 antibody, Anti-C3ORF39 antibody, Chromosome ORF-3 antibody, FLJ14566 antibody, Chromosome ORF 3, Chromosome 3 ORF, AGO61 antibody, Chromosome ORF-3, Chromosome ORF 3 antibody
Specificity C3ORF39 antibody was raised against the middle region of C3Orf39
Cross Reactivity Human,Mouse,Rat,Dog
Applications WB
Immunogen C3ORF39 antibody was raised using the middle region of C3Orf39 corresponding to a region with amino acids TTLFLPRGATVVELFPYAVNPDHYTPYKTLAMLPGMDLQYVAWRNMMPEN
Assay Information C3ORF39 Blocking Peptide, catalog no. 33R-9323, is also available for use as a blocking control in assays to test for specificity of this C3ORF39 antibody

Images

Western Blot analysis using C3ORF39 antibody (70R-1568)

C3ORF39 antibody (70R-1568) used at 1.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 66 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of C3ORF39 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of Chromosome 3 ORF protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using C3ORF39 antibody (70R-1568) | C3ORF39 antibody (70R-1568) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: £220.34
Size: 100 ug
OR
Shipping
View Our Distributors