C3orf49 antibody (70R-4569)

Rabbit polyclonal C3orf49 antibody raised against the middle region of C3orf49

Synonyms Polyclonal C3orf49 antibody, Anti-C3orf49 antibody, Chromosome ORF 3, Chromosome 3 ORF, Chromosome ORF-3, Chromosome 3 Open Reading Frame 49 antibody, MGC17310 antibody, Chromosome ORF-3 antibody, Chromosome ORF 3 antibody
Specificity C3orf49 antibody was raised against the middle region of C3orf49
Cross Reactivity Human
Applications WB
Immunogen C3orf49 antibody was raised using the middle region of C3orf49 corresponding to a region with amino acids IQLDVVEAETEEITQGNTLLRARRTTKRLSVTSLPSGLQKGPYSPKKRPH
Assay Information C3orf49 Blocking Peptide, catalog no. 33R-4115, is also available for use as a blocking control in assays to test for specificity of this C3orf49 antibody


Western Blot analysis using C3orf49 antibody (70R-4569)

C3orf49 antibody (70R-4569) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 33 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C3orf49 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of Chromosome 3 ORF protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using C3orf49 antibody (70R-4569) | C3orf49 antibody (70R-4569) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors