C4ORF23 antibody (70R-4167)

Rabbit polyclonal C4ORF23 antibody raised against the N terminal Of C4Orf23

Synonyms Polyclonal C4ORF23 antibody, Anti-C4ORF23 antibody, Chromosome ORF-4 antibody, Chromosome 4 ORF, FLJ35725 antibody, FLJ12891 antibody, Chromosome ORF 4, Chromosome ORF-4, Chromosome ORF 4 antibody
Specificity C4ORF23 antibody was raised against the N terminal Of C4Orf23
Cross Reactivity Human,Rat
Applications WB
Immunogen C4ORF23 antibody was raised using the N terminal Of C4Orf23 corresponding to a region with amino acids LTPWIPVIAARSSYNCRFFVLPCCFFDFIGRYSRRQSKKTQYREYLDFIK
Assay Information C4ORF23 Blocking Peptide, catalog no. 33R-5486, is also available for use as a blocking control in assays to test for specificity of this C4ORF23 antibody

Images

Western Blot analysis using C4ORF23 antibody (70R-4167)

C4ORF23 antibody (70R-4167) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 41 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C4ORF23 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of Chromosome 4 ORF protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using C4ORF23 antibody (70R-4167) | C4ORF23 antibody (70R-4167) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors