C5ORF33 antibody (70R-4180)

Rabbit polyclonal C5ORF33 antibody raised against the middle region of C5Orf33

Synonyms Polyclonal C5ORF33 antibody, Anti-C5ORF33 antibody, MGC43298 antibody, Chromosome 5 ORF, Chromosome ORF 5, Chromosome ORF-5, FLJ30596 antibody, Chromosome ORF 5 antibody, Chromosome ORF-5 antibody
Specificity C5ORF33 antibody was raised against the middle region of C5Orf33
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen C5ORF33 antibody was raised using the middle region of C5Orf33 corresponding to a region with amino acids RWLWRQRIRLYLEGTGINPVPVDLHEQQLSLNQHNRALNIERAHDERSEA
Assay Information C5ORF33 Blocking Peptide, catalog no. 33R-8267, is also available for use as a blocking control in assays to test for specificity of this C5ORF33 antibody


Western Blot analysis using C5ORF33 antibody (70R-4180)

C5ORF33 antibody (70R-4180) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 49 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C5ORF33 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The specific function of C5orf33 is not yet known.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using C5ORF33 antibody (70R-4180) | C5ORF33 antibody (70R-4180) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors