C6ORF134 antibody (70R-1282)

Rabbit polyclonal C6ORF134 antibody raised against the N terminal Of C6Orf134

Synonyms Polyclonal C6ORF134 antibody, Anti-C6ORF134 antibody, FLJ13158 antibody, Chromosome ORF-6 antibody, DKFZp547J097 antibody, Chromosome 6 ORF, Chromosome ORF 6, Chromosome ORF-6, Chromosome ORF 6 antibody, DAQB-47P19.10 antibody, Nbla00487 antibody
Specificity C6ORF134 antibody was raised against the N terminal Of C6Orf134
Cross Reactivity Human,Mouse,Rat,Dog
Applications WB
Immunogen C6ORF134 antibody was raised using the N terminal Of C6Orf134 corresponding to a region with amino acids MEFPFDVDALFPERITVLDQHLRPPARRPGTTTPARVDLQQQIMTIIDEL
Assay Information C6ORF134 Blocking Peptide, catalog no. 33R-5915, is also available for use as a blocking control in assays to test for specificity of this C6ORF134 antibody


Western Blot analysis using C6ORF134 antibody (70R-1282)

C6ORF134 antibody (70R-1282) used at 2.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 36 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of C6ORF134 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of Chromosome 6 ORF protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using C6ORF134 antibody (70R-1282) | C6ORF134 antibody (70R-1282) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: £199.84
Size: 100 ug
View Our Distributors