C6orf134 antibody (70R-3914)

Rabbit polyclonal C6orf134 antibody raised against the N terminal of C6orf134

Synonyms Polyclonal C6orf134 antibody, Anti-C6orf134 antibody, Chromosome 6 ORF, Chromosome ORF-6, Chromosome 6 Open Reading Frame 134 antibody, Chromosome ORF 6 antibody, Nbla00487 antibody, Chromosome ORF-6 antibody, FLJ13158 antibody, DKFZp547J097 antibody, Chromosome ORF 6
Specificity C6orf134 antibody was raised against the N terminal of C6orf134
Cross Reactivity Human
Applications WB
Immunogen C6orf134 antibody was raised using the N terminal of C6orf134 corresponding to a region with amino acids MEFPFDVDALFPERITVLDQHLRPPARRPGTTTPARVDLQQQIMTIIDEL
Assay Information C6orf134 Blocking Peptide, catalog no. 33R-5914, is also available for use as a blocking control in assays to test for specificity of this C6orf134 antibody

Images

Western Blot analysis using C6orf134 antibody (70R-3914)

C6orf134 antibody (70R-3914) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 36 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C6orf134 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of C6orf134 protein has not been widely studied, and is yet to be fully elucidated.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using C6orf134 antibody (70R-3914) | C6orf134 antibody (70R-3914) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors