C6ORF146 antibody (70R-3608)

Rabbit polyclonal C6ORF146 antibody raised against the middle region of C6Orf146

Synonyms Polyclonal C6ORF146 antibody, Anti-C6ORF146 antibody, Chromosome 6 ORF, Chromosome ORF 6, Chromosome ORF 6 antibody, Chromosome ORF-6, Chromosome ORF-6 antibody, MGC43581 antibody
Specificity C6ORF146 antibody was raised against the middle region of C6Orf146
Cross Reactivity Human
Applications WB
Immunogen C6ORF146 antibody was raised using the middle region of C6Orf146 corresponding to a region with amino acids ETLPAPNWNLKHGNSSVEENFTDESDLSENEKTNDTLLSYFKKVDLNLKP
Assay Information C6ORF146 Blocking Peptide, catalog no. 33R-2765, is also available for use as a blocking control in assays to test for specificity of this C6ORF146 antibody


Western Blot analysis using C6ORF146 antibody (70R-3608)

C6ORF146 antibody (70R-3608) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 57 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C6ORF146 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The specific function of C6orf146 is not yet known.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using C6ORF146 antibody (70R-3608) | C6ORF146 antibody (70R-3608) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors