C9ORF127 antibody (70R-1846)

Rabbit polyclonal C9ORF127 antibody raised against the middle region of C9Orf127

Synonyms Polyclonal C9ORF127 antibody, Anti-C9ORF127 antibody, MGC120460 antibody, NGX6 antibody, RP11-112J3.10 antibody, Chromosome 9 ORF, Chromosome ORF-9, NAG-5 antibody, Chromosome ORF 9, Chromosome ORF 9 antibody, Chromosome ORF-9 antibody
Specificity C9ORF127 antibody was raised against the middle region of C9Orf127
Cross Reactivity Human,Mouse,Rat,Dog
Applications IHC, WB
Immunogen C9ORF127 antibody was raised using the middle region of C9Orf127 corresponding to a region with amino acids THNYLYAACECKAGWRGWGCTDSADALTYGFQLLSTLLLCLSNLMFLPPV
Assay Information C9ORF127 Blocking Peptide, catalog no. 33R-9108, is also available for use as a blocking control in assays to test for specificity of this C9ORF127 antibody


Immunohistochemical staining using C9ORF127 antibody (70R-1846)

C9ORF127 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of intestinal villus (arrows) in Human Intestine. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 52 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of C9ORF127 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The down-regulation of C9orf127 may be closely associated with tumorigenesis and metastasis of colorectal carcinoma. However, it may not contribute to the development and progression of gastric carcinoma.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using C9ORF127 antibody (70R-1846) | C9ORF127 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of intestinal villus (arrows) in Human Intestine. Magnification is at 400X
  • Western Blot analysis using C9ORF127 antibody (70R-1846) | C9ORF127 antibody (70R-1846) used at 5 ug/ml to detect target protein.

Availability: In stock

Price: £199.84
Size: 100 ug
View Our Distributors