C9ORF43 antibody (70R-4411)

Rabbit polyclonal C9ORF43 antibody raised against the middle region of C9Orf43

Synonyms Polyclonal C9ORF43 antibody, Anti-C9ORF43 antibody, MGC17358 antibody, Chromosome ORF-9, Chromosome ORF 9 antibody, Chromosome ORF-9 antibody, Chromosome 9 ORF, Chromosome ORF 9
Specificity C9ORF43 antibody was raised against the middle region of C9Orf43
Cross Reactivity Human
Applications WB
Immunogen C9ORF43 antibody was raised using the middle region of C9Orf43 corresponding to a region with amino acids PEAQAARQKKISFNFSEIMASTGWNSELKLLRILQDTDDEDEEDQSSGAE
Assay Information C9ORF43 Blocking Peptide, catalog no. 33R-7032, is also available for use as a blocking control in assays to test for specificity of this C9ORF43 antibody

Images

Western Blot analysis using C9ORF43 antibody (70R-4411)

C9ORF43 antibody (70R-4411) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 52 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C9ORF43 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of the C9orf43 protein has not been widely studied, and is yet to be fully elucidated.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using C9ORF43 antibody (70R-4411) | C9ORF43 antibody (70R-4411) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors