CABC1 antibody (70R-2496)

Rabbit polyclonal CABC1 antibody

Synonyms Polyclonal CABC1 antibody, Anti-CABC1 antibody, ADCK3 antibody, COQ8 antibody, Chaperone Abc1 Activity Of Bc1 Complex Homolog antibody, MGC4849 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen CABC1 antibody was raised using a synthetic peptide corresponding to a region with amino acids FANPRDSFSAMGFQRRFFHQDQSPVGGLTAEDIEKARQAKARPENKQHKQ
Assay Information CABC1 Blocking Peptide, catalog no. 33R-2845, is also available for use as a blocking control in assays to test for specificity of this CABC1 antibody


Western Blot analysis using CABC1 antibody (70R-2496)

CABC1 antibody (70R-2496) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 72 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CABC1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CABC1 is a mitochondrial protein similar to yeast ABC1, which functions in an electron-transferring membrane protein complex in the respiratory chain. It is not related to the family of ABC transporter proteins. Expression of this gene is induced by the tumor suppressor p53 and in response to DNA damage, and inhibiting its expression partially suppresses p53-induced apoptosis.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CABC1 antibody (70R-2496) | CABC1 antibody (70R-2496) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors