CACNB2 antibody (70R-5064)

Rabbit polyclonal CACNB2 antibody raised against the middle region of CACNB2

Synonyms Polyclonal CACNB2 antibody, Anti-CACNB2 antibody, MYSB antibody, Calcium Channel Voltage-Dependent Beta 2 Subunit antibody, CACNLB2 antibody, FLJ23743 antibody, CACNB 2, CACNB2, CACNB 2 antibody, CACNB-2, CACNB-2 antibody
Specificity CACNB2 antibody was raised against the middle region of CACNB2
Cross Reactivity Human
Applications WB
Immunogen CACNB2 antibody was raised using the middle region of CACNB2 corresponding to a region with amino acids HLADYLEAYWKATHPPSSSLPNPLLSRTLATSSLPLSPTLASNSQGSQGD
Assay Information CACNB2 Blocking Peptide, catalog no. 33R-3772, is also available for use as a blocking control in assays to test for specificity of this CACNB2 antibody


Western Blot analysis using CACNB2 antibody (70R-5064)

CACNB2 antibody (70R-5064) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 68 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CACNB2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CACNB2 contributes to the function of the calcium channel by increasing peak calcium current, shifting the voltage dependencies of activation and inactivation, modulating G protein inhibition and controlling the alpha-1 subunit membrane targeting. Defects in CACNB2 are the cause of Brugada syndrome type 4 (BRS4).

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CACNB2 antibody (70R-5064) | CACNB2 antibody (70R-5064) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors