CACNB2 antibody (70R-5066)

Rabbit polyclonal CACNB2 antibody raised against the n terminal of CACNB2

Synonyms Polyclonal CACNB2 antibody, Anti-CACNB2 antibody, CACNB2, CACNB 2, CACNB-2 antibody, CACNLB2 antibody, CACNB 2 antibody, FLJ23743 antibody, CACNB-2, Calcium Channel Voltage-Dependent Beta 2 Subunit antibody, MYSB antibody
Specificity CACNB2 antibody was raised against the n terminal of CACNB2
Cross Reactivity Human
Applications WB
Immunogen CACNB2 antibody was raised using the N terminal of CACNB2 corresponding to a region with amino acids IQMELLENVAPAGALGAAAQSYGKGARRKNRFKGSDGSTSSDTTSNSFVR
Assay Information CACNB2 Blocking Peptide, catalog no. 33R-4120, is also available for use as a blocking control in assays to test for specificity of this CACNB2 antibody


Western Blot analysis using CACNB2 antibody (70R-5066)

CACNB2 antibody (70R-5066) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 73 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CACNB2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CACNB2 belongs to the calcium channel beta subunit family.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CACNB2 antibody (70R-5066) | CACNB2 antibody (70R-5066) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors