CACNB3 antibody (70R-5061)

Rabbit polyclonal CACNB3 antibody raised against the n terminal of CACNB3

Synonyms Polyclonal CACNB3 antibody, Anti-CACNB3 antibody, CACNB-3 antibody, CACNB 3, Calcium Channel Voltage-Dependent Beta 3 Subunit antibody, CACNB3, CACNB-3, CACNB 3 antibody
Specificity CACNB3 antibody was raised against the n terminal of CACNB3
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen CACNB3 antibody was raised using the N terminal of CACNB3 corresponding to a region with amino acids MYDDSYVPGFEDSEAGSADSYTSRPSLDSDVSLEEDRESARREVESQAQQ
Assay Information CACNB3 Blocking Peptide, catalog no. 33R-6623, is also available for use as a blocking control in assays to test for specificity of this CACNB3 antibody

Images

Western Blot analysis using CACNB3 antibody (70R-5061)

CACNB3 antibody (70R-5061) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 49 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CACNB3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The L-type calcium channel is composed of four subunits: alpha-1, alpha-2, beta and gamma. The beta subunit of voltage-dependent calcium channels contributes to the function of the calcium channel by increasing peak calcium current, shifting the voltage dependencies of activation and inactivation, modulating G protein inhibition and controlling the alpha-1 subunit membrane targeting.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CACNB3 antibody (70R-5061) | CACNB3 antibody (70R-5061) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors