CACNB4 antibody (70R-5065)

Rabbit polyclonal CACNB4 antibody raised against the middle region of CACNB4

Synonyms Polyclonal CACNB4 antibody, Anti-CACNB4 antibody, CACNB 4 antibody, CACNB4, Calcium Channel Voltage-Dependent Beta 4 Subunit antibody, CACNB 4, CACNB-4 antibody, CACNB-4
Specificity CACNB4 antibody was raised against the middle region of CACNB4
Cross Reactivity Human
Applications WB
Immunogen CACNB4 antibody was raised using the middle region of CACNB4 corresponding to a region with amino acids GVPDPGTGASSGTRTPDVKAFLESPWSLDPASASPEPVPHILASSRQWDP
Assay Information CACNB4 Blocking Peptide, catalog no. 33R-3649, is also available for use as a blocking control in assays to test for specificity of this CACNB4 antibody

Images

Western Blot analysis using CACNB4 antibody (70R-5065)

CACNB4 antibody (70R-5065) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 50 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CACNB4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CACNB4 is a member of the beta subunit family of voltage-dependent calcium channel complex proteins. Calcium channels mediate the influx of calcium ions into the cell upon membrane polarization and consist of a complex of alpha-1, alpha-2/delta, beta, and gamma subunits in a 1:1:1:1 ratio. Various versions of each of these subunits exist, either expressed from similar genes or the result of alternative splicing. CACNB4 plays an important role in calcium channel function by modulating G protein inhibition, increasing peak calcium current, controlling the alpha-1 subunit membrane targeting and shifting the voltage dependence of activation and inactivation. Certain mutations in this gene have been associated with idiopathic generalized epilepsy (IGE) and juvenile myoclonic epilepsy (JME).

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CACNB4 antibody (70R-5065) | CACNB4 antibody (70R-5065) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors