CACNG4 antibody (70R-5189)

Rabbit polyclonal CACNG4 antibody raised against the N terminal of CACNG4

Synonyms Polyclonal CACNG4 antibody, Anti-CACNG4 antibody, CACNG-4, CACNG 4, CACNG 4 antibody, CACNG4, MGC24983 antibody, CACNG-4 antibody, Calcium Channel Voltage-Dependent Gamma Subunit 4 antibody, MGC11138 antibody
Specificity CACNG4 antibody was raised against the N terminal of CACNG4
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen CACNG4 antibody was raised using the N terminal of CACNG4 corresponding to a region with amino acids GPPPRRARGDLTHSGLWRVCCIEGIYKGHCFRINHFPEDNDYDHDSSEYL
Assay Information CACNG4 Blocking Peptide, catalog no. 33R-3479, is also available for use as a blocking control in assays to test for specificity of this CACNG4 antibody


Western Blot analysis using CACNG4 antibody (70R-5189)

CACNG4 antibody (70R-5189) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 36 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CACNG4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance L-type calcium channels are composed of five subunits. CACNG4 represents one of these subunits, gamma, and is one of several gamma subunit proteins. It is an integral membrane protein that is thought to stabilize the calcium channel in an inactive (closed) state. This gene is a member of the neuronal calcium channel gamma subunit geneubfamily of the PMP-22/EMP/MP20 family.L-type calcium channels are composed of five subunits.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CACNG4 antibody (70R-5189) | CACNG4 antibody (70R-5189) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors