CACNG6 antibody (70R-1499)

Rabbit polyclonal CACNG6 antibody raised against the N terminal of CACNG6

Synonyms Polyclonal CACNG6 antibody, Anti-CACNG6 antibody, CACNG 6, Calcium Channel Voltage-Dependent Gamma Subunit 6 antibody, CACNG6, CACNG-6 antibody, CACNG-6, CACNG 6 antibody
Specificity CACNG6 antibody was raised against the N terminal of CACNG6
Cross Reactivity Human
Applications WB
Immunogen CACNG6 antibody was raised using the N terminal of CACNG6 corresponding to a region with amino acids RAHGQGRSGLTPEREGKVKLALLLAAVGATLAVLSVGTEFWVELNTYKAN
Assay Information CACNG6 Blocking Peptide, catalog no. 33R-7808, is also available for use as a blocking control in assays to test for specificity of this CACNG6 antibody

Images

Western Blot analysis using CACNG6 antibody (70R-1499)

CACNG6 antibody (70R-1499) used at 1.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 24 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of CACNG6 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance L-type calcium channels are composed of five subunits. The protein encoded by CACNG6 represents one of these subunits, gamma, and is one of several gamma subunit proteins. It is an integral membrane protein that is thought to stabilize the calcium channel in an inactive (closed) state. CACNG6 is a member of the neuronal calcium channel gamma subunit geneubfamily of the PMP-22/EMP/MP20 family and is located in a cluster with two similar gamma subunit-encoding genes.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CACNG6 antibody (70R-1499) | CACNG6 antibody (70R-1499) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: £220.34
Size: 100 ug
OR
Shipping
View Our Distributors