CACYBP antibody (70R-1064)

Rabbit polyclonal CACYBP antibody raised against the middle region of CACYBP

Synonyms Polyclonal CACYBP antibody, Anti-CACYBP antibody, MGC87971 antibody, S100A6BP antibody, Calcyclin Binding Protein antibody, RP1-102G20.6 antibody, SIP antibody, PNAS-107 antibody, GIG5 antibody
Specificity CACYBP antibody was raised against the middle region of CACYBP
Cross Reactivity Human,Dog
Applications WB
Immunogen CACYBP antibody was raised using the middle region of CACYBP corresponding to a region with amino acids FTERSFDLLVKNLNGKSYSMIVNNLLKPISVEGSSKKVKTDTVLILCRKK
Assay Information CACYBP Blocking Peptide, catalog no. 33R-3089, is also available for use as a blocking control in assays to test for specificity of this CACYBP antibody

Images

Western Blot analysis using CACYBP antibody (70R-1064)

CACYBP antibody (70R-1064) used at 5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 26 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of CACYBP antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CACYBP is a calcyclin binding protein. It may be involved in calcium-dependent ubiquitination and subsequent proteosomal degradation of target proteins. It probably serves as a molecular bridge in ubiquitin E3 complexes and participates in the ubiquitin-mediated degradation of beta-catenin.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CACYBP antibody (70R-1064) | CACYBP antibody (70R-1064) used at 5 ug/ml to detect target protein.

Availability: In stock

Price: £220.34
Size: 100 ug
OR
Shipping
View Our Distributors