Calponin 2 antibody (70R-2274)

Rabbit polyclonal Calponin 2 antibody raised against the N terminal of CNN2

Synonyms Polyclonal Calponin 2 antibody, Anti-Calponin 2 antibody, CNN2 antibody
Specificity Calponin 2 antibody was raised against the N terminal of CNN2
Cross Reactivity Human,Mouse
Applications WB
Immunogen Calponin 2 antibody was raised using the N terminal of CNN2 corresponding to a region with amino acids YGLSAEVKNRLLSKYDPQKEAELRTWIEGLTGLSIGPDFQKGLKDGTILC
Assay Information Calponin 2 Blocking Peptide, catalog no. 33R-10105, is also available for use as a blocking control in assays to test for specificity of this Calponin 2 antibody


Western Blot analysis using Calponin 2 antibody (70R-2274)

Calponin 2 antibody (70R-2274) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 34 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CNN2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CNN2, which can bind actin, calmodulin, troponin C, and tropomyosin, may function in the structural organization of actin filaments. CNN2 could play a role in smooth muscle contraction and cell adhesion.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Calponin 2 antibody (70R-2274) | Calponin 2 antibody (70R-2274) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £276.43
Size: 50 ug
View Our Distributors