Calreticulin 3 antibody (70R-5390)

Rabbit polyclonal Calreticulin 3 antibody raised against the N terminal of CALR3

Synonyms Polyclonal Calreticulin 3 antibody, Anti-Calreticulin 3 antibody, MGC26577 antibody, FLJ25355 antibody, CRT2 antibody, CALR3 antibody
Specificity Calreticulin 3 antibody was raised against the N terminal of CALR3
Cross Reactivity Human
Applications WB
Immunogen Calreticulin 3 antibody was raised using the N terminal of CALR3 corresponding to a region with amino acids MAGPQQQPPYLHLAELTASQFLEIWKHFDADGNGYIEGKELENFFQELEK
Assay Information Calreticulin 3 Blocking Peptide, catalog no. 33R-5666, is also available for use as a blocking control in assays to test for specificity of this Calreticulin 3 antibody

Images

Western Blot analysis using Calreticulin 3 antibody (70R-5390)

Calreticulin 3 antibody (70R-5390) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 42 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CALR3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Calreticulins, such as CALR3, are Ca(2+)-binding chaperones localized mainly in the endoplasmic/sarcoplasmic reticulum.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Calreticulin 3 antibody (70R-5390) | Calreticulin 3 antibody (70R-5390) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors