CAMK1D antibody (70R-3991)

Rabbit polyclonal CAMK1D antibody raised against the middle region of CAMK1D

Synonyms Polyclonal CAMK1D antibody, Anti-CAMK1D antibody, Calcium/Calmodulin-Dependent Protein Kinase Id antibody, CKLiK antibody, CAMK1D antibody, CaMK1D antibody, CaM-K1 antibody
Specificity CAMK1D antibody was raised against the middle region of CAMK1D
Cross Reactivity Human
Applications WB
Immunogen CAMK1D antibody was raised using the middle region of CAMK1D corresponding to a region with amino acids KNIHESVSAQIRKNFAKSKWRQAFNATAVVRHMRKLHLGSSLDSSNASVS
Assay Information CAMK1D Blocking Peptide, catalog no. 33R-4567, is also available for use as a blocking control in assays to test for specificity of this CAMK1D antibody

Images

Western Blot analysis using CAMK1D antibody (70R-3991)

CAMK1D antibody (70R-3991) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 42 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CAMK1D antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a member of the Ca2+/calmodulin-dependent protein kinase 1 subfamily of serine/threonine kinases. The encoded protein may be involved in the regulation of granulocyte function through the chemokine signal transduction pathway. Alternatively spliced transcript variants encoding different isoforms of this gene have been described.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CAMK1D antibody (70R-3991) | CAMK1D antibody (70R-3991) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors