CAMLG antibody (70R-2352)

Rabbit polyclonal CAMLG antibody raised against the N terminal of CAMLG

Synonyms Polyclonal CAMLG antibody, Anti-CAMLG antibody, MGC163197 antibody, CAML antibody, Calcium Modulating Ligand antibody
Specificity CAMLG antibody was raised against the N terminal of CAMLG
Cross Reactivity Human
Applications WB
Immunogen CAMLG antibody was raised using the N terminal of CAMLG corresponding to a region with amino acids LLMNSEQRINRIMGFHRPGSGAEEESQTKSKQQDSDKLNSLSVPSVSKRV
Assay Information CAMLG Blocking Peptide, catalog no. 33R-5170, is also available for use as a blocking control in assays to test for specificity of this CAMLG antibody

Western Blot analysis using CAMLG antibody (70R-2352)

CAMLG antibody (70R-2352) used at 1 ug/ml to detect target protein.

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 33 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CAMLG antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The immunosuppressant drug cyclosporin A blocks a calcium-dependent signal from the T-cell receptor (TCR) that normally leads to T-cell activation. When bound to cyclophilin B, cyclosporin A binds and inactivates the key signaling intermediate calcineurin. CAMLG functions similarly to cyclosporin A, binding to cyclophilin B and acting downstream of the TCR and upstream of calcineurin by causing an influx of calcium. This integral membrane protein appears to be a new participant in the calcium signal transduction pathway, implicating cyclophilin B in calcium signaling, even in the absence of cyclosporin.

Add a Paper

Sorry, but there are no references currently for this product.

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

  • Western Blot analysis using CAMLG antibody (70R-2352) | CAMLG antibody (70R-2352) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £276.43
Size: 50 ug
View Our Distributors