Carbonic Anhydrase VIII antibody (70R-1122)

Rabbit polyclonal Carbonic Anhydrase VIII antibody raised against the N terminal of CA8

Synonyms Polyclonal Carbonic Anhydrase VIII antibody, Anti-Carbonic Anhydrase VIII antibody, Car8 antibody, CALS antibody, CARP antibody, MGC120502 antibody, CA-VIII antibody, CA8 antibody, MGC99509 antibody
Specificity Carbonic Anhydrase VIII antibody was raised against the N terminal of CA8
Cross Reactivity Human,Mouse,Rat,Dog,ZebraFish
Applications WB
Immunogen Carbonic Anhydrase VIII antibody was raised using the N terminal of CA8 corresponding to a region with amino acids YEEGVEWGLVFPDANGEYQSPINLNSREARYDPSLLDVRLSPNYVVCRDC
Assay Information Carbonic Anhydrase VIII Blocking Peptide, catalog no. 33R-10083, is also available for use as a blocking control in assays to test for specificity of this Carbonic Anhydrase VIII antibody

Images

Western Blot analysis using Carbonic Anhydrase VIII antibody (70R-1122)

Carbonic Anhydrase VIII antibody (70R-1122) used at 5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 32 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of CA8 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CA8 was initially named CA-related protein because of sequence similarity to other known carbonic anhydrase genes. However, CA8 lacks carbonic anhydrase activity (i.e., the reversible hydration of carbon dioxide). CA8 continues to carry a carbonic anhydrase designation based on clear sequence identity to other members of the carbonic anhydrase gene family.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Carbonic Anhydrase VIII antibody (70R-1122) | Carbonic Anhydrase VIII antibody (70R-1122) used at 5 ug/ml to detect target protein.

Availability: In stock

Price: £220.34
Size: 100 ug
OR
Shipping
View Our Distributors