Carboxypeptidase B1 antibody (70R-5447)

Rabbit polyclonal Carboxypeptidase B1 antibody

Synonyms Polyclonal Carboxypeptidase B1 antibody, Anti-Carboxypeptidase B1 antibody, CPB1 antibody, DKFZp779K1333 antibody, PCPB antibody, PASP antibody
Cross Reactivity Human
Applications WB
Immunogen Carboxypeptidase B1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SRVRATGHSYEKYNKWETIEAWTQQVATENPALISRSVIGTTFEGRAIYL
Assay Information Carboxypeptidase B1 Blocking Peptide, catalog no. 33R-8785, is also available for use as a blocking control in assays to test for specificity of this Carboxypeptidase B1 antibody


Western Blot analysis using Carboxypeptidase B1 antibody (70R-5447)

Carboxypeptidase B1 antibody (70R-5447) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 35 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CPB1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Three different procarboxypeptidases A and two different procarboxypeptidases B have been isolated. The B1 and B2 forms differ from each other mainly in isoelectric point. Carboxypeptidase B1 is a highly tissue-specific protein and is a useful serum marker for acute pancreatitis and dysfunction of pancreatic transplants. It is not elevated in pancreatic carcinoma.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Carboxypeptidase B1 antibody (70R-5447) | Carboxypeptidase B1 antibody (70R-5447) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £272.51
Size: 50 ug
View Our Distributors