Carboxypeptidase B2 antibody (70R-5364)

Rabbit polyclonal Carboxypeptidase B2 antibody

Synonyms Polyclonal Carboxypeptidase B2 antibody, Anti-Carboxypeptidase B2 antibody, TAFI antibody, PCPB antibody, CPU antibody, CPB2 antibody
Cross Reactivity Human
Applications WB
Immunogen Carboxypeptidase B2 antibody was raised using a synthetic peptide corresponding to a region with amino acids RSKSKDHEELSLVASEAVRAIEKTSKNTRYTHGHGSETLYLAPGGGDDWI
Assay Information Carboxypeptidase B2 Blocking Peptide, catalog no. 33R-8190, is also available for use as a blocking control in assays to test for specificity of this Carboxypeptidase B2 antibody


Western Blot analysis using Carboxypeptidase B2 antibody (70R-5364)

Carboxypeptidase B2 antibody (70R-5364) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 36 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CPB2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Carboxypeptidases are enzymes that hydrolyze C-terminal peptide bonds. The carboxypeptidase family includes metallo-, serine, and cysteine carboxypeptidases. According to their substrate specificity, these enzymes are referred to as carboxypeptidase A (cleaving aliphatic residues) or carboxypeptidase B (cleaving basic amino residues). CPB2 is activated by trypsin and acts on carboxypeptidase B substrates. After thrombin activation, the mature protein downregulates fibrinolysis.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Carboxypeptidase B2 antibody (70R-5364) | Carboxypeptidase B2 antibody (70R-5364) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors