Carboxypeptidase N2 antibody (70R-3276)

Rabbit polyclonal Carboxypeptidase N2 antibody raised against the N terminal of CPN2

Synonyms Polyclonal Carboxypeptidase N2 antibody, Anti-Carboxypeptidase N2 antibody, ACBP antibody, Carboxypeptidase N-2 antibody, CPN2 antibody, Carboxypeptidase N-2, Carboxypeptidase N Polypeptide 2 antibody, Carboxypeptidase N 2, Carboxypeptidase N 2 antibody, Carboxypeptidase N2
Specificity Carboxypeptidase N2 antibody was raised against the N terminal of CPN2
Cross Reactivity Human
Applications WB
Immunogen Carboxypeptidase N2 antibody was raised using the N terminal of CPN2 corresponding to a region with amino acids FTTLETRAFGSNPNLTKVVFLNTQLCQFRPDAFGGLPRLEDLEVTGSSFL
Assay Information Carboxypeptidase N2 Blocking Peptide, catalog no. 33R-3103, is also available for use as a blocking control in assays to test for specificity of this Carboxypeptidase N2 antibody


Western Blot analysis using Carboxypeptidase N2 antibody (70R-3276)

Carboxypeptidase N2 antibody (70R-3276) used at 0.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 60 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CPN2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CPN2 contains 13 LRR (leucine-rich) repeats. The 83 kDa subunit binds and stabilizes the catalytic subunit at 37 degrees Celsius and keeps it in circulation. Under some circumstances it may be an allosteric modifier of the catalytic subunit.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Carboxypeptidase N2 antibody (70R-3276) | Carboxypeptidase N2 antibody (70R-3276) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors