Cardiotrophin 1 antibody (70R-5254)

Rabbit polyclonal Cardiotrophin 1 antibody raised against the N terminal of CTF1

Synonyms Polyclonal Cardiotrophin 1 antibody, Anti-Cardiotrophin 1 antibody, CT1 antibody, CT-1 antibody, CTF1 antibody
Specificity Cardiotrophin 1 antibody was raised against the N terminal of CTF1
Cross Reactivity Human
Applications WB
Immunogen Cardiotrophin 1 antibody was raised using the N terminal of CTF1 corresponding to a region with amino acids MSRREGSLEDPQTDSSVSLLPHLEAKIRQTHSLAHLLTKYAEQLLQEYVQ
Assay Information Cardiotrophin 1 Blocking Peptide, catalog no. 33R-6489, is also available for use as a blocking control in assays to test for specificity of this Cardiotrophin 1 antibody

Images

Western Blot analysis using Cardiotrophin 1 antibody (70R-5254)

Cardiotrophin 1 antibody (70R-5254) used at 0.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 21 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CTF1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CTF1 induces cardiac myocyte hypertrophy in vitro. It binds to and activates the ILST/gp130 receptor. It belongs to the IL-6 superfamily.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Cardiotrophin 1 antibody (70R-5254) | Cardiotrophin 1 antibody (70R-5254) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors