CARF antibody (70R-1349)

Rabbit polyclonal CARF antibody raised against the C terminal Of Carf

Synonyms Polyclonal CARF antibody, Anti-CARF antibody, Collaborator of ARF antibody
Specificity CARF antibody was raised against the C terminal Of Carf
Cross Reactivity Human,Mouse,Rat,Dog
Applications IHC, WB
Immunogen CARF antibody was raised using the C terminal Of Carf corresponding to a region with amino acids AIEALKATLDVFFVPLKELADLPQNKSSQESIVCELRCKSVYLGTGCGKS
Assay Information CARF Blocking Peptide, catalog no. 33R-1263, is also available for use as a blocking control in assays to test for specificity of this CARF antibody


Immunohistochemical staining using CARF antibody (70R-1349)

CARF antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Skeletal muscle cells (arrows) in Human Muscle. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 64 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of CARF antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.3125 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CARF was first cloned as a novel binding partner of ARF from a yeast-interactive screen. CARF and ARF colocalize in the perinucleolar region and have a collaborative function. In the nucleoplasm, CARF interacts with p53 and enhances its function. The p53 downregulates CARF in a negative feedback regulatory loop and may also involve p53 antagonist HDM2.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using CARF antibody (70R-1349) | CARF antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Skeletal muscle cells (arrows) in Human Muscle. Magnification is at 400X
  • Western Blot analysis using CARF antibody (70R-1349) | CARF antibody (70R-1349) used at 0.3125 ug/ml to detect target protein.

Availability: In stock

Price: £199.84
Size: 100 ug
View Our Distributors