CARS antibody (70R-4848)

Rabbit polyclonal CARS antibody raised against the middle region of CARS

Synonyms Polyclonal CARS antibody, Anti-CARS antibody, CYSRS antibody, Cysteinyl-tRNA Synthetase antibody, MGC:11246 antibody, CARS1 antibody
Specificity CARS antibody was raised against the middle region of CARS
Cross Reactivity Human,Rat
Applications WB
Immunogen CARS antibody was raised using the middle region of CARS corresponding to a region with amino acids QEQEAAKLAKMKIPPSEMFLSETDKYSKFDENGLPTHDMEGKELSKGQAK
Assay Information CARS Blocking Peptide, catalog no. 33R-7537, is also available for use as a blocking control in assays to test for specificity of this CARS antibody

Images

Western Blot analysis using CARS antibody (70R-4848)

CARS antibody (70R-4848) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 95 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CARS antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CARS is a class 1 aminoacyl-tRNA synthetase, cysteinyl-tRNA synthetase. Each of the twenty aminoacyl-tRNA synthetases catalyzes the aminoacylation of a specific tRNA or tRNA isoaccepting family with the cognate amino acid. CARS gene is one of several located near the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian, and breast cancer. Alternative splicing of this gene results in multiple transcript variants encoding distinct isoforms.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CARS antibody (70R-4848) | CARS antibody (70R-4848) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors