Catenin antibody (70R-2491)

Rabbit polyclonal Catenin antibody

Synonyms Polyclonal Catenin antibody, Anti-Catenin antibody, CTNND1 antibody, CTNND antibody, P120CTN antibody, P120CAS antibody, KIAA0384 antibody, Cadherin-Associated Protein Delta 1 antibody, p120 antibody, CAS antibody
Cross Reactivity Human
Applications WB
Immunogen Catenin antibody was raised using a synthetic peptide corresponding to a region with amino acids QTIWGYKELRKPLEKEGWKKSDFQVNLNNASRSQSSHSYDDSTLPLIDRN
Assay Information Catenin Blocking Peptide, catalog no. 33R-7753, is also available for use as a blocking control in assays to test for specificity of this Catenin antibody


Western Blot analysis using Catenin antibody (70R-2491)

Catenin antibody (70R-2491) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 108 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CTNND1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a member of the Armadillo protein family, which function in adhesion between cells and signal transduction. Multiple translation initiation codons and althernative splicing result in many different isoforms being translated. Not all of the full-length natures of the described transcript variants have been determined.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Catenin antibody (70R-2491) | Catenin antibody (70R-2491) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £276.43
Size: 50 ug
View Our Distributors