CATSPER2 antibody (70R-1488)

Rabbit polyclonal CATSPER2 antibody raised against the N terminal of CATSPER2

Synonyms Polyclonal CATSPER2 antibody, Anti-CATSPER2 antibody, Cation Channel Sperm Associated 2 antibody, MGC33346 antibody
Specificity CATSPER2 antibody was raised against the N terminal of CATSPER2
Cross Reactivity Human
Applications IHC, WB
Immunogen CATSPER2 antibody was raised using the N terminal of CATSPER2 corresponding to a region with amino acids HLQGLSQAVPRHTIRELLDPSRQKKLVLGDQHQLVRFSIKPQRIEQISHA
Assay Information CATSPER2 Blocking Peptide, catalog no. 33R-3784, is also available for use as a blocking control in assays to test for specificity of this CATSPER2 antibody


Immunohistochemical staining using CATSPER2 antibody (70R-1488)

CATSPER2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Neural cells (arrows) in Human Brain. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 46 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of CATSPER2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Calcium ions play a primary role in the regulation of sperm motility. Anti-CATSPER2 belongs to a family of putative cation channels that are specific to spermatozoa and localize to the flagellum. The protein family features a single repeat with six membrane-spanning segments and a predicted calcium-selective pore region. A second, closely linked copy of this gene has been identified. Although multiple transcript variants encoding protein isoforms have been characterized, they seem to be only transcribed from this gene. Additional splice variants have been described but their full-length nature has not been determined.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using CATSPER2 antibody (70R-1488) | CATSPER2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Neural cells (arrows) in Human Brain. Magnification is at 400X
  • Western Blot analysis using CATSPER2 antibody (70R-1488) | CATSPER2 antibody (70R-1488) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: £199.84
Size: 100 ug
View Our Distributors