CATSPER2 antibody (70R-5069)

Rabbit polyclonal CATSPER2 antibody raised against the N terminal of CATSPER2

Synonyms Polyclonal CATSPER2 antibody, Anti-CATSPER2 antibody, Cation Channel Sperm Associated 2 antibody, MGC33346 antibody
Specificity CATSPER2 antibody was raised against the N terminal of CATSPER2
Cross Reactivity Human
Applications WB
Immunogen CATSPER2 antibody was raised using the N terminal of CATSPER2 corresponding to a region with amino acids HLQGLSQAVPRHTIRELLDPSRQKKLVLGDQHQLVRFSIKPQRIEQISHA
Assay Information CATSPER2 Blocking Peptide, catalog no. 33R-3783, is also available for use as a blocking control in assays to test for specificity of this CATSPER2 antibody

Images

Western Blot analysis using CATSPER2 antibody (70R-5069)

CATSPER2 antibody (70R-5069) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 46 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CATSPER2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Calcium ions play a primary role in the regulation of sperm motility. Anti-CATSPER2 belongs to a family of putative cation channels that are specific to spermatozoa and localize to the flagellum. The protein family features a single repeat with six membrane-spanning segments and a predicted calcium-selective pore region. A second, closely linked copy of this gene has been identified. Although multiple transcript variants encoding protein isoforms have been characterized, they seem to be only transcribed from this gene. Additional splice variants have been described but their full-length nature has not been determined.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CATSPER2 antibody (70R-5069) | CATSPER2 antibody (70R-5069) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors