CCDC138 antibody (70R-3552)

Rabbit polyclonal CCDC138 antibody raised against the N terminal of CCDC138

Synonyms Polyclonal CCDC138 antibody, Anti-CCDC138 antibody, CCDC 138, CCDC 138 antibody, FLJ32745 antibody, CCDC138, CCDC-138, Coiled-Coil Domain Containing 138 antibody, CCDC-138 antibody
Specificity CCDC138 antibody was raised against the N terminal of CCDC138
Cross Reactivity Human
Applications WB
Immunogen CCDC138 antibody was raised using the N terminal of CCDC138 corresponding to a region with amino acids EPRVVKPPGQDLVVESLKSRYGLGGSCPDEYDFSNFYQSKYKRRTLTSPG
Assay Information CCDC138 Blocking Peptide, catalog no. 33R-2646, is also available for use as a blocking control in assays to test for specificity of this CCDC138 antibody


Western Blot analysis using CCDC138 antibody (70R-3552)

CCDC138 antibody (70R-3552) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 76 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CCDC138 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of the CCDC138 protein has not been widely studied, and is yet to be fully elucidated.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CCDC138 antibody (70R-3552) | CCDC138 antibody (70R-3552) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors