CCDC52 antibody (70R-3396)

Rabbit polyclonal CCDC52 antibody raised against the N terminal of CCDC52

Synonyms Polyclonal CCDC52 antibody, Anti-CCDC52 antibody, FLJ44949 antibody, FLJ26064 antibody, CCDC 52 antibody, Coiled-Coil Domain Containing 52 antibody, CCDC52, CCDC-52 antibody, CCDC 52, CCDC-52
Specificity CCDC52 antibody was raised against the N terminal of CCDC52
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen CCDC52 antibody was raised using the N terminal of CCDC52 corresponding to a region with amino acids TVTDLTVHRATPEDLVRRHEIHKSKNRALVHWELQEKALKRKWRKQKPET
Assay Information CCDC52 Blocking Peptide, catalog no. 33R-9371, is also available for use as a blocking control in assays to test for specificity of this CCDC52 antibody


Western Blot analysis using CCDC52 antibody (70R-3396)

CCDC52 antibody (70R-3396) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 96 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CCDC52 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The specific function of CCDC52 is not yet known.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CCDC52 antibody (70R-3396) | CCDC52 antibody (70R-3396) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors