CCDC63 antibody (70R-3568)

Rabbit polyclonal CCDC63 antibody raised against the middle region of CCDC63

Synonyms Polyclonal CCDC63 antibody, Anti-CCDC63 antibody, CCDC-63 antibody, CCDC 63 antibody, Coiled-Coil Domain Containing 63 antibody, CCDC63, CCDC 63, FLJ35843 antibody, CCDC-63
Specificity CCDC63 antibody was raised against the middle region of CCDC63
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen CCDC63 antibody was raised using the middle region of CCDC63 corresponding to a region with amino acids EQSSQAYEQRVEAMARMAAMKDRQKKDTSQYNLEIRELERLYAHESKLKS
Assay Information CCDC63 Blocking Peptide, catalog no. 33R-2679, is also available for use as a blocking control in assays to test for specificity of this CCDC63 antibody


Western Blot analysis using CCDC63 antibody (70R-3568)

CCDC63 antibody (70R-3568) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 66 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CCDC63 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of CCDC63 protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CCDC63 antibody (70R-3568) | CCDC63 antibody (70R-3568) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors