CCDC69 antibody (70R-3544)

Rabbit polyclonal CCDC69 antibody raised against the middle region of CCDC69

Synonyms Polyclonal CCDC69 antibody, Anti-CCDC69 antibody, FLJ13705 antibody, CCDC69, CCDC-69 antibody, CCDC 69 antibody, DKFZP434C171 antibody, CCDC 69, Coiled-Coil Domain Containing 69 antibody, CCDC-69
Specificity CCDC69 antibody was raised against the middle region of CCDC69
Cross Reactivity Human
Applications WB
Immunogen CCDC69 antibody was raised using the middle region of CCDC69 corresponding to a region with amino acids TREALEKEVQLRRQLQQEKEELLYRVLGANASPAFPLAPVTPTEVSFLAT
Assay Information CCDC69 Blocking Peptide, catalog no. 33R-9255, is also available for use as a blocking control in assays to test for specificity of this CCDC69 antibody


Western Blot analysis using CCDC69 antibody (70R-3544)

CCDC69 antibody (70R-3544) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 35 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CCDC69 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of CCDC69 has not been widely studied, and is yet to be fully elucidated.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CCDC69 antibody (70R-3544) | CCDC69 antibody (70R-3544) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors