CCDC74A antibody (70R-4386)

Rabbit polyclonal CCDC74A antibody raised against the middle region of CCDC74A

Synonyms Polyclonal CCDC74A antibody, Anti-CCDC74A antibody, Coiled-Coil Domain Containing 74A antibody, FLJ40345 antibody, CCDCA-74 antibody, CCDCA 74 antibody, CCDC74A, CCDCA 74, CCDCA-74
Specificity CCDC74A antibody was raised against the middle region of CCDC74A
Cross Reactivity Human
Applications WB
Immunogen CCDC74A antibody was raised using the middle region of CCDC74A corresponding to a region with amino acids FPKVSTKSLSKKCLSPPVAERAILPALKQTPKNNFAERQKRLQAMQKRRL
Assay Information CCDC74A Blocking Peptide, catalog no. 33R-3020, is also available for use as a blocking control in assays to test for specificity of this CCDC74A antibody


Western Blot analysis using CCDC74A antibody (70R-4386)

CCDC74A antibody (70R-4386) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 42 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CCDC74A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of CCDC74A protein has not been widely studied, and is yet to be fully elucidated.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CCDC74A antibody (70R-4386) | CCDC74A antibody (70R-4386) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors