CCDC87 antibody (70R-4369)

Rabbit polyclonal CCDC87 antibody raised against the N terminal of CCDC87

Synonyms Polyclonal CCDC87 antibody, Anti-CCDC87 antibody, CCDC 87, CCDC87, FLJ10786 antibody, Coiled-Coil Domain Containing 87 antibody, CCDC 87 antibody, CCDC-87, CCDC-87 antibody
Specificity CCDC87 antibody was raised against the N terminal of CCDC87
Cross Reactivity Human
Applications WB
Immunogen CCDC87 antibody was raised using the N terminal of CCDC87 corresponding to a region with amino acids MMEPPKPEPELQRFYHRLLRPLSLFPTRTTSPEPQKRPPQEGRILQSFPL
Assay Information CCDC87 Blocking Peptide, catalog no. 33R-6230, is also available for use as a blocking control in assays to test for specificity of this CCDC87 antibody


Western blot analysis using CCDC87 antibody (70R-4369)

Recommended CCDC87 Antibody Titration: 0.2-1 ug/ml


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 96 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CCDC87 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of CCDC87 protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western blot analysis using CCDC87 antibody (70R-4369) | Recommended CCDC87 Antibody Titration: 0.2-1 ug/ml

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors