CCT7 antibody (70R-5634)

Rabbit polyclonal CCT7 antibody

Synonyms Polyclonal CCT7 antibody, Anti-CCT7 antibody, CCT-ETA antibody, Eta antibody, Ccth antibody, Chaperonin Containing Tcp1 Subunit 7 antibody, TCP-1-eta antibody, MGC110985 antibody, Nip7-1 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen CCT7 antibody was raised using a synthetic peptide corresponding to a region with amino acids RAIKNDSVVAGGGAIEMELSKYLRDYSRTIPGKQQLLIGAYAKALEIIPR
Assay Information CCT7 Blocking Peptide, catalog no. 33R-7811, is also available for use as a blocking control in assays to test for specificity of this CCT7 antibody

Images

Western Blot analysis using CCT7 antibody (70R-5634)

CCT7 antibody (70R-5634) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 60 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CCT7 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CCT7 is a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CCT7 antibody (70R-5634) | CCT7 antibody (70R-5634) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £272.51
Size: 50 ug
OR
Shipping
View Our Distributors