CDCA7L antibody (70R-3880)

Rabbit polyclonal CDCA7L antibody raised against the middle region of CDCA7L

Synonyms Polyclonal CDCA7L antibody, Anti-CDCA7L antibody, CDCA 7 antibody, CDCA-7, CDCA 7, JPO2 antibody, CDCA7, RAM2 antibody, CDCA-7 antibody, R1 antibody, Cell Division Cycle Associated 7-Like antibody, DKFZp762L0311 antibody
Specificity CDCA7L antibody was raised against the middle region of CDCA7L
Cross Reactivity Human
Applications WB
Immunogen CDCA7L antibody was raised using the middle region of CDCA7L corresponding to a region with amino acids PPCRGICNCSYCRKRDGRCATGILIHLAKFYGYDNVKEYLESLQKELVED
Assay Information CDCA7L Blocking Peptide, catalog no. 33R-7245, is also available for use as a blocking control in assays to test for specificity of this CDCA7L antibody


Western Blot analysis using CDCA7L antibody (70R-3880)

CDCA7L antibody (70R-3880) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 46 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CDCA7L antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CDCA7L plays an important oncogenic role in mediating the full transforming effect of MYC in medulloblastoma cells. CDCA7L is involved in apoptotic signaling pathways. CDCA7L may act downstream of P38-kinase and BCL-2, but upstream of CASP3/caspase-3 as well as CCND1/cyclin D1 and E2F1.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CDCA7L antibody (70R-3880) | CDCA7L antibody (70R-3880) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors