CDKL2 antibody (70R-3300)

Rabbit polyclonal CDKL2 antibody

Synonyms Polyclonal CDKL2 antibody, Anti-CDKL2 antibody, KKIAMRE antibody, CDKL 2, Cyclin-Dependent Kinase-Like 2 antibody, CDKL 2 antibody, CDKL-2, CDKL-2 antibody, CDKL2, Cdc2-Related Kinase antibody, P56 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen CDKL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MEKYENLGLVGEGSYGMVMKCRNKDTGRIVAIKKFLESDDDKMVKKIAMR
Assay Information CDKL2 Blocking Peptide, catalog no. 33R-5933, is also available for use as a blocking control in assays to test for specificity of this CDKL2 antibody


Western Blot analysis using CDKL2 antibody (70R-3300)

CDKL2 antibody (70R-3300) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 54 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CDKL2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene product is a member of a large family of CDC2-related serine/threonine protein kinases. It accumulates primarily in the cytoplasm, with lower levels in the nucleus.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CDKL2 antibody (70R-3300) | CDKL2 antibody (70R-3300) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors