CDKN2AIP antibody (70R-4954)

Rabbit polyclonal CDKN2AIP antibody raised against the N terminal of CDKN2AIP

Synonyms Polyclonal CDKN2AIP antibody, Anti-CDKN2AIP antibody, CARF antibody, FLJ20036 antibody, Cdkn2A Interacting Protein antibody
Specificity CDKN2AIP antibody was raised against the N terminal of CDKN2AIP
Cross Reactivity Human
Applications WB
Immunogen CDKN2AIP antibody was raised using the N terminal of CDKN2AIP corresponding to a region with amino acids RRDFLLRNAGDLAPAGGAASASTDEAADAESGTRNRQLQQLISFSMAWAN
Assay Information CDKN2AIP Blocking Peptide, catalog no. 33R-8130, is also available for use as a blocking control in assays to test for specificity of this CDKN2AIP antibody


Western Blot analysis using CDKN2AIP antibody (70R-4954)

CDKN2AIP antibody (70R-4954) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 61 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CDKN2AIP antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The CDKN2AIP protein activates TP53/p53 by CDKN2A-dependent and CDKN2A-independent pathways.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CDKN2AIP antibody (70R-4954) | CDKN2AIP antibody (70R-4954) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors