CDKN3 antibody (70R-5506)

Rabbit polyclonal CDKN3 antibody

Synonyms Polyclonal CDKN3 antibody, Anti-CDKN3 antibody, CIP2 antibody, MGC70625 antibody, KAP1 antibody, Cyclin-Dependent Kinase Inhibitor 3 antibody, CDI1 antibody, FLJ25787 antibody, Cdk2-Associated Dual Specificity Phosphatase antibody, KAP antibody
Cross Reactivity Human
Applications WB
Immunogen CDKN3 antibody was raised using a synthetic peptide corresponding to a region with amino acids CKFKDVRRNVQKDTEELKSCGIQDIFVFCTRGELSKYRVPNLLDLYQQCG
Assay Information CDKN3 Blocking Peptide, catalog no. 33R-1720, is also available for use as a blocking control in assays to test for specificity of this CDKN3 antibody


Western Blot analysis using CDKN3 antibody (70R-5506)

CDKN3 antibody (70R-5506) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 23 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CDKN3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene belongs to the dual specificity protein phosphatase family. It was identified as a cyclin-dependent kinase inhibitor, and has been shown to interact with, and dephosphorylate CDK2 kinase, thus prevent the activation of CDK2 kinase. This gene was reported to be deleted, mutated, or overexpressed in several kinds of cancers.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CDKN3 antibody (70R-5506) | CDKN3 antibody (70R-5506) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors