CDRT4 antibody (70R-3796)

Rabbit polyclonal CDRT4 antibody raised against the middle region of CDRT4

Synonyms Polyclonal CDRT4 antibody, Anti-CDRT4 antibody, Cmt1A Duplicated Region Transcript 4 antibody, NBLA10383 antibody, MGC33988 antibody, FLJ36674 antibody
Specificity CDRT4 antibody was raised against the middle region of CDRT4
Cross Reactivity Human
Applications WB
Immunogen CDRT4 antibody was raised using the middle region of CDRT4 corresponding to a region with amino acids TSQTVKRLIEKSKTRELECMRALEERPWASRQNKPSSVIQPKRRKSSKSS
Assay Information CDRT4 Blocking Peptide, catalog no. 33R-9293, is also available for use as a blocking control in assays to test for specificity of this CDRT4 antibody


Western Blot analysis using CDRT4 antibody (70R-3796)

CDRT4 antibody (70R-3796) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 17 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CDRT4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The specific function of CDRT4 is not yet known.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CDRT4 antibody (70R-3796) | CDRT4 antibody (70R-3796) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors