CDYL antibody (70R-2099)

Rabbit polyclonal CDYL antibody raised against the n terminal of CDYL

Synonyms Polyclonal CDYL antibody, Anti-CDYL antibody, DKFZP586C1622 antibody, CDYL1 antibody, MGC131936 antibody, Chromodomain Protein Y-Like antibody
Specificity CDYL antibody was raised against the n terminal of CDYL
Cross Reactivity Human
Applications WB
Immunogen CDYL antibody was raised using the N terminal of CDYL corresponding to a region with amino acids YIHDFNRRHTEKQKESTLTRTNRTSPNNARKQISRSTNSNFSKTSPKALV
Assay Information CDYL Blocking Peptide, catalog no. 33R-10137, is also available for use as a blocking control in assays to test for specificity of this CDYL antibody

Images

Western Blot analysis using CDYL antibody (70R-2099)

CDYL antibody (70R-2099) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 60 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CDYL antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CDYL acts as repressor of transcription. CDYL has histone acetyltransferase activity, with a preference for histone H4.Chromodomain Y is a primate-specific Y-chromosomal gene family expressed exclusively in the testis and implicated in infertility. Although the Y-linked genes are testis-specific, this autosomal gene is ubiquitously expressed. The Y-linked genes arose by retrotransposition of an mRNA from this gene, followed by amplification of the retroposed gene.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CDYL antibody (70R-2099) | CDYL antibody (70R-2099) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £276.43
Size: 50 ug
OR
Shipping
View Our Distributors