CENPA antibody (70R-1035)

Rabbit polyclonal CENPA antibody raised against the N terminal of CENPA

Synonyms Polyclonal CENPA antibody, Anti-CENPA antibody, Centromere Protein A antibody
Specificity CENPA antibody was raised against the N terminal of CENPA
Cross Reactivity Human
Applications IHC, WB
Immunogen CENPA antibody was raised using the N terminal of CENPA corresponding to a region with amino acids MGPRRRSRKPEAPRRRSPSPTPTPGPSRRGPSLGASSHQHSRRRQGWLKE
Assay Information CENPA Blocking Peptide, catalog no. 33R-6060, is also available for use as a blocking control in assays to test for specificity of this CENPA antibody


Immunohistochemical staining using CENPA antibody (70R-1035)

CENPA antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 16 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of CENPA antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Centromeres are the differentiated chromosomal domains that specify the mitotic behavior of chromosomes. CENPA is a centromere protein which contains a histone H3 related histone fold domain that is required for targeting to the centromere. CENPA is proposed to be a component of a modified nucleosome or nucleosome-like structure in which it replaces 1 or both copies of conventional histone H3 in the (H3-H4)2 tetrameric core of the nucleosome particle.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using CENPA antibody (70R-1035) | CENPA antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using CENPA antibody (70R-1035) | CENPA antibody (70R-1035) used at 1.25 ug/ml to detect target protein.
  • Immunohistochemical staining using CENPA antibody (70R-1035) | CENPA antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Squamous epithelial cells (arrows) in Human Skin. Magnification is at 400X

Availability: In stock

Price: £220.34
Size: 100 ug
View Our Distributors